Protein information for: OR1L8



MERINHTSSVSEFILLGLSSRPEDQKTLFVLFLIVYLVTITGNLLIILAI
RFNPHLQTPMYFFLSFLSLTDICFTTSVVPKMLMNFLSEKKTISYAGCLT
QMYFLYALGNSDSCLLAVMAFDRYVAVCDPFHYVTTMSHHHCVLLVAFSC
SFPHLHSLLHTLLLNRLTFCDSNVIHHFLCDLSPVLKLSCSSIFVNEIVQ
MTEAPIVLVTRFLCIAFSYIRILTTVLKIPSTSGKRKAFSTCGFYLTVVT
LFYGSIFCVYLQPPSTYAVKDHVATIVYTVLSSMLNPFIYSLRNKDLKQG
LRKLMSKRS
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 25 51 QKTLFVLFLIVYLVTITGNLLIILAIR
TM2 62 84 FFLSFLSLTDICFTTSVVPKMLM
TM3 99 119 LTQMYFLYALGNSDSCLLAVM
TM4 142 162 CVLLVAFSCSFPHLHSLLHTL
TM5 199 220 VQMTEAPIVLVTRFLCIAFSYI
TM6 242 266 CGFYLTVVTLFYGSIFCVYLQPPST
TM7 271 289 HVATIVYTVLSSMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage