Protein information for: OR1M4P



MEPGNQTSASQFILLGLSEKPEQETLLFSLFLCMYLVTVLGNLLIILAIS
IDSHFHTPMYFFLANLSLIDFCLATNTIPKMLVSLQTGSKAISYPXXCKH
SWALYGEAVALCLTPRHWERKPFLTPRCYRKGVXIQIPREGSWISGKSTK
XKQVF
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 ETLLFSLFLCMYLVTVLGNLLIILAIS
TM2 61 83 FFLANLSLIDFCLATNTIPKMLV
TM3 97 115 CKHSWALYGEAVALCLTPR
TM4 135 155 IQIPREGSWISGKSTKXKQVF
TM5 155 154
TM6 155 154
TM7 155 154

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage