Protein information for: OR1R1P



MAPTNLTSAPVFLLLGLVDGTDAHPLLFLLCLGIYLLNALSNLSMVALVR
SDGALRSPMYYFLGHLSLVDVCFTTVTVPRLLAGLLHPGQAISFQACFAE
MYFFVALGITESYLLAAMSYDRPTAACRPLRYGALVTPWRCASLVRASWA
VTHLHSLLHTLLLSALSYPYPTPVRPFFCDMTVMLSLATSDTSAAETAIF
SEGLAVVLAPLLLVFLSYARILVAVLGLPRPRRAFSTCGAHLVAVALFFG
SVLSVYFPPSSAYSARYDRLASVVYAVITPTLNPFINSLRNKEVKGALKR
GLRWRAAPQEA
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 HPLLFLLCLGIYLLNALSNLSMVALVR
TM2 61 83 YFLGHLSLVDVCFTTVTVPRLLA
TM3 98 118 FAEMYFFVALGITESYLLAAM
TM4 141 161 CASLVRASWAVTHLHSLLHTL
TM5 198 219 AIFSEGLAVVLAPLLLVFLSYA
TM6 238 262 CGAHLVAVALFFGSVLSVYFPPSSA
TM7 268 287 DRLASVVYAVITPTLNPFIN

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage