Protein information for: OR1X1P



GGKENETGVGEFLLLSITSDSEKQQALFWLFLCMHLVTEAGNTPIILGIG
SNPRLHTPTYFFTHLSFVNICFITNLIPKLLVNHVAGTGMITISSPQCLT
QMYFLISFANVDTFLLAIMALDHYVAICSALRYCSIISPRLCQGLAVLAX
AGSSLISLVHTVIMSRLAFCSSAQISHFYCDAYLLMKIACSNIHVNQHVF
LGAVVLFLAPCALILVSYIRIAAAILRIPSPTRRRKACSICSSHLSLVTL
FYGTVLGICIXPPDSFSAQDTIATIMYTVVTSMLNPFIYSLMNKEVQEAV
RRLFSRGSHSSWC
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 QQALFWLFLCMHLVTEAGNTPIILGIG
TM2 60 82 YFFTHLSFVNICFITNLIPKLLV
TM3 99 119 LTQMYFLISFANVDTFLLAIM
TM4 142 162 CQGLAVLAXAGSSLISLVHTV
TM5 198 219 HVFLGAVVLFLAPCALILVSYI
TM6 241 265 CSSHLSLVTLFYGTVLGICIXPPDS
TM7 270 288 TIATIMYTVVTSMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage