Protein information for: OR2A15P



MGCHQSMVTEFILVGFQLSAEMEVLLFWSFSLGIALELICLDHSLHTPYF
FLSHLAVIDMSYASNNVPKMLVDLANXKSTMCFFPCIMQTFLYLAFAHIE
CLILVVLSYDRYVAICHPLRYNVLMSWRECTVLAVASWVFSFLLALVHLV
LILRLPFSGPHEINHYCEILSVLKLACADTWLNQVVIFAACMFILVGSLC
LVLVSYLGILAAILRIQSGEGRRKAFSTCSSHLCVVEFFFGNAIVMYMAP
KSRHPEEQQKVLSLFCSLWNQVLNPLIYSLRNAEVKSAQKRALRKERLM
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 17 40 QLSAEMEVLLFWSFSLGIALELIC
TM2 50 72 FFLSHLAVIDMSYASNNVPKMLV
TM3 87 107 IMQTFLYLAFAHIECLILVVL
TM4 130 150 CTVLAVASWVFSFLLALVHLV
TM5 186 207 VIFAACMFILVGSLCLVLVSYL
TM6 229 253 CSSHLCVVEFFFGNAIVMYMAPKSR
TM7 259 278 QKVLSLFCSLWNQVLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage