Protein information for: OR2A5



MTKNQTWVTEFILLGFPLSLRIQMLLSGLFSLLYVFTLLGNGAILGLIWL
DSRLHTPMYFFLSHLAIIDISYASNNVPKMLTNLGLNKRKTISFVPCTMQ
TFLYMAFAHTECLILVMMSYDRYMAICHPLQYSVIMRWGVCTVLAVTSWA
CGSLLALVHVVLILRLPFCGPHEINHFFCEILSVLKLACADTWLNQVVIF
AASVFILVGPLCLVLVSYSRILAAILRIQSGEGRRKAFSTCSSHLCMVGL
FFGSAIVMYMAPKSRHPEEQQKVLSLFYSLFNPMLNPLIYSLRNAEVKGA
LKRVLWKQRSK
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 23 49 QMLLSGLFSLLYVFTLLGNGAILGLIW
TM2 60 82 FFLSHLAIIDISYASNNVPKMLT
TM3 98 118 TMQTFLYMAFAHTECLILVMM
TM4 141 161 CTVLAVTSWACGSLLALVHVV
TM5 198 219 VIFAASVFILVGPLCLVLVSYS
TM6 241 265 CSSHLCMVGLFFGSAIVMYMAPKSR
TM7 271 290 QKVLSLFYSLFNPMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage