Protein information for: OR2AD1P



METSSVSSGTDFILLGFSDRPQLEHIISVVVFIIYIVTLVGNTTIILVSY
LDTQLHTFMYFFLSNLSFLDLCYTTSIIPQMLANQWGPKKSITYGGCVLQ
FFFVLDLGATECLLLAVMAYDRYAAVCQPLHYTLKCTLSFATAWLSGLAS
ALIVCSLTLKLPRCGHREVDNFFCEMPALIKMACVYSKVIEIVVFAFGVV
FLFVPLSLILISYGVITQAVMRIKSATRLQKILNTCGSHLTVVILFYGTI
IYIYMKPQNTISQDEGKFSLFYTIITPSLNLPIYTLRNKDVKSALKRILW
MKKSSAESXIRWKKVEC
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 EHIISVVVFIIYIVTLVGNTTIILVSY
TM2 61 83 FFLSNLSFLDLCYTTSIIPQMLA
TM3 98 118 VLQFFFVLDLGATECLLLAVM
TM4 136 156 CTLSFATAWLSGLASALIVCS
TM5 193 214 VVFAFGVVFLFVPLSLILISYG
TM6 236 260 CGSHLTVVILFYGTIIYIYMKPQNT
TM7 265 283 GKFSLFYTIITPSLNLPIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage