Protein information for: OR2AF1P



MTELILVGFAQHPEIQTAFFLELLFFYIVTAFENILIVAVVRXDSRLHTP
MGFFFLSTLSSLEMCYSISWELXVLAQCIKDFPTISYNSCSVQMITHLFL
GSDECLLLAGMAYNRFVEISYLLHYTIIMSNRVCIQLALGIWTHAFLVAV
TLIIAIPASYYGHNVINHFTCEIQALLKLVCSDTLVSLIQGLVISVFTLP
LPFTFILISXFCIFVRAVEARREAFSTCGSHLTGVTIFYGAAICMYLKPQ
SKGTQEEDKVVSKLYGAVTPMLNPPIYIQRNKDIKGALRKLAKGNEKS
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 16 42 QTAFFLELLFFYIVTAFENILIVAVVR
TM2 54 76 FFLSTLSSLEMCYSISWELXVLA
TM3 91 111 SVQMITHLFLGSDECLLLAGM
TM4 134 154 CIQLALGIWTHAFLVAVTLII
TM5 190 211 QGLVISVFTLPLPFTFILISXF
TM6 228 252 CGSHLTGVTIFYGAAICMYLKPQSK
TM7 258 277 DKVVSKLYGAVTPMLNPPIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage