Protein information for: OR2AL1P



MGNINISLENYFILLGLSNXPPLEIVIFVVLLIFCFMTLIGKLFSIILSY
LDSHPHTPRYLFSFLDFCYTISSIFXLQYNLWGPQKNISYASGMIQIYFV
LTLGTMDCALLVVMSMDCDAAGHRHLPYTVVMAVAFWVSSFTNSAFDSFF
TFWVTLCGHHYYAYIFIFTSLLVXRWCHXQKETVCVLTESCSFINIIFSI
INDCFQEIEKNMLRISTASGESESMXSCSIKPSIKNMHFYETILGNSSFR
MRLNYEGQNKXXKIILTXVKXKFIYLPHKKNFKD
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 EIVIFVVLLIFCFMTLIGKLFSIILSY
TM2 61 79 LFSFLDFCYTISSIFXLQY
TM3 94 114 MIQIYFVLTLGTMDCALLVVM
TM4 130 148 VMAVAFWVSSFTNSAFDSF
TM5 185 206 CVLTESCSFINIIFSIINDCFQ
TM6 228 252 CSIKPSIKNMHFYETILGNSSFRMR
TM7 257 274 QNKXXKIILTXVKXKFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage