Protein information for: OR2AO1P



MGGKQPWVTEFILVGFQLCAEMEIFLSCIFSRFYAFSLLRNGMNMGLTYL
DDRDHTLIYIFLSHLAINDMYYASNNVPKRQVNQMNQKKKTLFYGXMQIF
LYLAFAHTECLIXAMMSCNRYVAICXIFLQPFTLSLWVLLCVRXVSXIWX
TDGSYFFNANYHSVPFKXAINPQLILVCEDLTCHEDVNWLLCGFYCVVAL
QNLWAMYLSVFLXXKTSFFCFHVXSSLKGLLXTPSSGNTFPXHLLVWERF
YFSFIY
No N-glycosylation site was found.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 23 49 EIFLSCIFSRFYAFSLLRNGMNMGLTY
TM2 60 82 IFLSHLAINDMYYASNNVPKRQV
TM3 96 116 XMQIFLYLAFAHTECLIXAMM
TM4 131 148 FTLSLWVLLCVRXVSXIW
TM5 150 166 TDGSYFFNANYHSVPFK
TM6 175 199 ILVCEDLTCHEDVNWLLCGFYCVVA
TM7 213 223 XKTSFFCFHVX

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage