Protein information for: OR2B8P



MCXQRMDQKNGSSFTGFILLGFSDRPQLELVLFVVFLIFYIFTLLGNKTI
IVLSHLDPHLHNPMYFFFSNLSFLDLCYTTGIVPQLLVNLRGADKSISYG
GCVVQLYISLGLGSTECVLLGVMAFDRYAAVCRPLHYTVVMHPCLYVLMA
STSWVIGFANSLLQTVLILLLTLCGRNKLEHFLCEVPPLLKLACVDTTMN
ESELFFVSVIILLVPVALIIFSYSQIVRAVVRIKSATGQRKVFGTCGSHL
TVVSLFYGTAIYAYLQPGNNYSQDQGKFISLFYTIITPMINPLIYTLRNK
DVKGALKKVLWKNYDSR
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 29 55 ELVLFVVFLIFYIFTLLGNKTIIVLSH
TM2 66 88 FFFSNLSFLDLCYTTGIVPQLLV
TM3 103 123 VVQLYISLGLGSTECVLLGVM
TM4 146 166 YVLMASTSWVIGFANSLLQTV
TM5 203 224 ELFFVSVIILLVPVALIIFSYS
TM6 246 270 CGSHLTVVSLFYGTAIYAYLQPGNN
TM7 276 295 GKFISLFYTIITPMINPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage