Protein information for: OR2E1P



MGFVKYPWLDFLLFCVLLTFYMFTLLGNSAIILVSQLDSQLHSPMYFLLT
SLSVLYLCFTTTTVPQMLFNLGGTNKNITXIGCMAQAYVFHWLACIECVL
LGIVALDCYVAVCKPPRYTIIIDHKVCLHLSSTAWLIGLANSLLQSTITI
QLPLXRCI
No N-glycosylation site was found.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 10 36 DFLLFCVLLTFYMFTLLGNSAIILVSQ
TM2 47 69 FLLTSLSVLYLCFTTTTVPQMLF
TM3 84 104 MAQAYVFHWLACIECVLLGIV
TM4 127 141 CLHLSSTAWLIGLAN
TM5 141 157 SLLQSTITIQLPLXRCI
TM6 158 157
TM7 158 157

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage