Protein information for: OR2H5P



EEQAMVNQSSAPGFLLLGFSEHPALERTLFVVVFTSYLLTLGGLIILLSV
LDPRLHSPMYFFLSNLSFLDLCFTISCVPGMLVNLWEPKKTIILLGCSVQ
FFIFLSLGTTECILLTVMAFDRYMAIFKPLRHATIVHLCLCWQLASVAWV
IGLVESVVQTPSTLRLPFCPHQQVDDFVCEVPALIRLSCEDTSYNEIQMA
VASVFILAVPSLILVSYGAIAWAVLRITAKGQRKAFGTCSSHLTVVTLFY
SSVIAVYLQPKNPYAQERGKFFGLFYAVGTPSLNPLIYTLRNKEVTRAFR
RLLAKEMGLIQS
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 26 50 ERTLFVVVFTSYLLTLGGLIILLSV
TM2 61 83 FFLSNLSFLDLCFTISCVPGMLV
TM3 98 118 SVQFFIFLSLGTTECILLTVM
TM4 141 161 CWQLASVAWVIGLVESVVQTP
TM5 198 218 QMAVASVFILAVPSLILVSYG
TM6 239 263 CSSHLTVVTLFYSSVIAVYLQPKNP
TM7 269 288 GKFFGLFYAVGTPSLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage