Protein information for: OR2Q1P



MGQENKNQTWVSEFILLGISSDWGIQVSLFALILAMYLVTILGNTLILLL
IRLDNRLHTPMYFSLSVLSFVDFCYTKSIVPQMLSHLLSARKSIPFYSCV
LQLYVSLALCGSEFFLLGAMAYDRYVAVCHPLHYTVIMHGGLCLGLAASR
LVAGFSNSLMETIITFQLPVSRFINHFVCETLAVLQLACVDVPFNKVMVA
ISGFLVILLPCSLVLFSYACIVATILCIRSTQVRCKAFGTCASHLIVVCM
CFGATICTYLGPQLASSAEEEKMIALFYGVVSPMLNPLIYSLRNKEVTAA
VRKVLERCR
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 26 52 QVSLFALILAMYLVTILGNTLILLLIR
TM2 63 85 FSLSVLSFVDFCYTKSIVPQMLS
TM3 100 120 VLQLYVSLALCGSEFFLLGAM
TM4 143 163 CLGLAASRLVAGFSNSLMETI
TM5 198 219 MVAISGFLVILLPCSLVLFSYA
TM6 241 265 CASHLIVVCMCFGATICTYLGPQLA
TM7 271 290 EKMIALFYGVVSPMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage