Protein information for: OR2R1P



MSQLGRDNITWVSEFILMGLSSDRQTQAGLFILFGAAYLLTLLGNGLILL
LIWLDVRLHLPMYFFLCNLSLVDICYTSSRVPQMLVHCTSERKTISFARC
GTQLFFSLALGGTEFLLLAAMAYDRYVAVCDPLCYIAVMSPRLCMALAAV
SWLVGLANSAMETALTMHLPTCGHNVLNHVACETLALVRSACVDITFNQV
VIVASSVVVLLVPCCLVSLSYTLIVVAVLQIHSTQGHRKAFGTCASHLTV
VSISYGMALFTYMQPRSMASAEQEKVMVLSYAVVTPMLNPFIYSLRNKDV
KAALSRALMRSSELKH
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 27 53 QAGLFILFGAAYLLTLLGNGLILLLIW
TM2 64 86 FFLCNLSLVDICYTSSRVPQMLV
TM3 101 121 GTQLFFSLALGGTEFLLLAAM
TM4 144 164 CMALAAVSWLVGLANSAMETA
TM5 201 222 VIVASSVVVLLVPCCLVSLSYT
TM6 244 268 CASHLTVVSISYGMALFTYMQPRSM
TM7 274 293 EKVMVLSYAVVTPMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage