Protein information for: OR2U2P



MINDSHFSGFILLGFTGQPQLQMMISGVVFFFYTIAFMGNMAIILLSFLD
DHLQVPMYFFLRNLAILDLCYTTNIVPQMLVSIWGKDKRITFGGCAFQLF
IDVALYSVECILLSMMSYDRLNAICKPLHHMTIMNLQLCQGLVVISWVVG
VINCIIPSPYATSLPRCRNHHLDHFFVCVKCLQXIACVDTTAMEVTTFAM
CLIIVLVPLLLILVSYGFIAVAVLKIKSAAGRQKAFGTCSSHLVVVSIFC
GTVTYMYIQPGNSPNQNEGKLLSIFYSIVTPSLNPLIYTVRNKEFKGAMK
RLTGKEKDCME
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 QMMISGVVFFFYTIAFMGNMAIILLSF
TM2 59 81 FFLRNLAILDLCYTTNIVPQMLV
TM3 96 116 AFQLFIDVALYSVECILLSMM
TM4 139 159 CQGLVVISWVVGVINCIIPSP
TM5 196 217 TTFAMCLIIVLVPLLLILVSYG
TM6 239 263 CSSHLVVVSIFCGTVTYMYIQPGNS
TM7 269 288 GKLLSIFYSIVTPSLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage