Protein information for: OR2W2P



PLSXPTRAAQKQFILLGFSGRPRLEHVLFVFVLIFYLVTLVGNIIIILIS
HLDPCLHMPMYFFLTNLSFLDLCFTTSSIPQLLFNLGSPGKTISHTGCAI
QLFMFLGLGGTECILLAAVAYDRFIAICKPLHYSVIMHPQLCWKLVSVAR
TPQFSSYVSWTMKLPRCGRCKLKHFLCEMPALIKITCVDTVAMESTVFTL
SVVIVLMPLCLILISYSYIALAVLRIKSAAGRRKAFNMCGSHLTVVSLFY
GNIIYMYMQPXNNSSQDQGKFLTLFYNLMTPMLNPVIYTLRNKDVKGALK
RLVSRKHSDSDCS
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 25 51 EHVLFVFVLIFYLVTLVGNIIIILISH
TM2 62 84 FFLTNLSFLDLCFTTSSIPQLLF
TM3 99 119 AIQLFMFLGLGGTECILLAAV
TM4 142 162 CWKLVSVARTPQFSSYVSWTM
TM5 196 217 TVFTLSVVIVLMPLCLILISYS
TM6 239 263 CGSHLTVVSLFYGNIIYMYMQPXNN
TM7 269 288 GKFLTLFYNLMTPMLNPVIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage