Protein information for: OR2W6P



LYLCYSQAFIFLCNRXYVAAGVENDNTSSFEGFILVGFSDRPHLELIVFV
VVLIFYLLTLLGNMTIVLLSALDSRLHTPMYFFLANLSFLDMCFTTGSIP
QMLYNLWGPDKTISYVGCAIQLYFVLALGGVECVLLAVMAYDRYAAVCKP
LHYTIIMHPRLCGQLASVAWLSGFGNSLIMAPQTLMLPRCGHRRVDHFLC
EMPALIGMACVDTMMLEALAFALAIFIILAPLILILISYGYVGGTVLRIK
SAAGRKKAFNTCSSHLIVVSLFYGTIIYMYLQPANTYSQDQGKFLTLFYT
IVTPSVNPLIYTLRNKDVKEAMKKVLGKGSAEI
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 45 71 ELIVFVVVLIFYLLTLLGNMTIVLLSA
TM2 82 104 FFLANLSFLDMCFTTGSIPQMLY
TM3 119 139 AIQLYFVLALGGVECVLLAVM
TM4 162 182 CGQLASVAWLSGFGNSLIMAP
TM5 219 240 LAFALAIFIILAPLILILISYG
TM6 262 286 CSSHLIVVSLFYGTIIYMYLQPANT
TM7 292 311 GKFLTLFYTIVTPSVNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage