Protein information for: OR3B1P



SVRGSKQLRNGTLVSQFLLKGLRDSKAWRPLLFTTFLLIYIVVVVGSHMF
TVDYRRHTPMYFFLGGHSLMDAACISNMVTQVLVHLLAPVGPVLYCACLI
QICFLHFLAPXESFLLTAVAYDSMLAICQPLHYFVLVGRLTHTGLTSISC
LLALANAFTYSILTALPKFCRPCLITHFFCDLPSLLRLSCFSTRTNELAL
FFSFLVALAHCVLVVVSYGHVVAAVQIHSTQGXRKAFSTCVAHLAMIGLF
YVTSVPCYILPNSAYSGLGDWVLSVLCVVLTHMLNPIFPSMLGXQAXATA
PARKYFLKER
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 29 51 RPLLFTTFLLIYIVVVVGSHMFT
TM2 62 84 FFLGGHSLMDAACISNMVTQVLV
TM3 99 119 LIQICFLHFLAPXESFLLTAV
TM4 142 162 HTGLTSISCLLALANAFTYSI
TM5 198 219 LALFFSFLVALAHCVLVVVSYG
TM6 240 264 CVAHLAMIGLFYVTSVPCYILPNSA
TM7 270 289 DWVLSVLCVVLTHMLNPIFP

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage