Protein information for: OR3D1P



MGVHNLFTVTQFILIGLSYFSNEHYLLFVALAIICQVFLVRSGDILLAIG
TVIKLHTTMYYFLANVSILDILCSSATIPKMPKILXTEDHSISFVRXALQ
PYFLVVLGWEESFLTVTAYDWCVVTCFSLCYILIMNKLVSVQLVYGTXAA
GFLNFLLLHVVSTLCLSFCKPDRVNQYYCDISPMGALLCQSMHLANMLVL
VESVILGISAFLAAFNFYIYIISTILKIQCVEWSAKCFSTCTSHLLTVCL
FYGILTFTYFTPSPVNTHMSKASPDLATDRLISMLYRVITLMFNFITDNL
RNTEVKASLRKV
No N-glycosylation site was found.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 HYLLFVALAIICQVFLVRSGDILLAIG
TM2 61 83 YFLANVSILDILCSSATIPKMPK
TM3 98 117 ALQPYFLVVLGWEESFLTVT
TM4 140 160 SVQLVYGTXAAGFLNFLLLHV
TM5 198 219 LVLVESVILGISAFLAAFNFYI
TM6 241 265 CTSHLLTVCLFYGILTFTYFTPSPV
TM7 279 298 DRLISMLYRVITLMFNFITD

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage