Protein information for: OR4A14P



MVLGLTYKSLIHLELIFVXGIRKGSSFSFLHMASQFSQHHLLNRESFPHF
LFLSGLSKIDSCRALFLRALFCSIDLAFLYTNESQIMSELPFTIASKRIK
YLGIQLTRDAKDLFKENPLLNEIKEVTNKWKNVPCSXVGRINIMKRPYCP
RXFINSMPSSSVNSMFQIVVVYSLPFCGSNVIDHIVCDMYPLLELACADT
YFIGLTVIANGGAICVVIFCLLLTSYGVILNFLKTYSQEGRHRTLSTCSS
HITVVVLFFVPCIFMYVRPVSNFPIDKFITEFYTVITPKLNPLIQPLRNX
EMRITMKKLWC
No N-glycosylation site was found.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 28 54 SFLHMASQFSQHHLLNRESFPHFLFLS
TM2 66 88 FLRALFCSIDLAFLYTNESQIMS
TM3 105 125 QLTRDAKDLFKENPLLNEIKE
TM4 149 169 CPRXFINSMPSSSVNSMFQIV
TM5 206 227 TVIANGGAICVVIFCLLLTSYG
TM6 248 272 CSSHITVVVLFFVPCIFMYVRPVSN
TM7 277 294 FITEFYTVITPKLNPLIQ

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage