Protein information for: OR4A17P



MGTSNNVTEFVLPGLSQDPDVQKALFVMFLLTYNVTMVGNLLIVVTIIAI
ASLDSPVSFFLACLSFIDAVYSTSFSPKLMIDLLCDKKTVSFLACMGQLF
INYPFGGIEVFLLVGMACDHYVDICKLLHYLTIMNWQVCILLFMVAVTGG
FLHSMFQIVVVYSLPFCGPNVIDHFCDMYPLLEMVCTDTYFIGLTVIANG
GAVCMVIFILLLISYGVILNSLKTYSQEGGHKALSTCSSNITVVSLFFDP
CIFIYVRPDSNFPIDKFMTVFYTIITSMLNPLIYTLRNLEVRIAVKKLWC
KN
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 QKALFVMFLLTYNVTMVGNLLIVVTII
TM2 59 81 FFLACLSFIDAVYSTSFSPKLMI
TM3 96 116 MGQLFINYPFGGIEVFLLVGM
TM4 139 159 CILLFMVAVTGGFLHSMFQIV
TM5 195 216 TVIANGGAVCMVIFILLLISYG
TM6 237 261 CSSNITVVSLFFDPCIFIYVRPDSN
TM7 266 283 FMTVFYTIITSMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage