Protein information for: OR4A18P



MYSTTLISTLSLHVLLLFXFVPFFSQIKVLALTXRCXNNXLVXSKVSDXP
NLHXSQLAFSWIITLAQPLHTQTCISFSNVIXCSTXLFTGHFFLGGSQIF
LLLVMAYGHYRAICKSLQYLVVMKQWLCVVLLVVSWAGGFLHIVIQLGLI
YGLPSYDPNVIGHFICDMDPLMKLVCDYTLNRFAYFAGHDXILGFMYFLM
LRLDCFLLVIRPHYSFVIFSLEDLVLXILLYIVIIPVASLEIRSLPQNYD
KGPNEFNXRRITFGDAPVEXLNNMCCSSNVDKVSTDFCPYFKEYL
No N-glycosylation site was found.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 21 47 VPFFSQIKVLALTXRCXNNXLVXSKVS
TM2 58 80 AFSWIITLAQPLHTQTCISFSNV
TM3 86 104 LFTGHFFLGGSQIFLLLVM
TM4 128 148 CVVLLVVSWAGGFLHIVIQLG
TM5 185 206 YFAGHDXILGFMYFLMLRLDCF
TM6 222 246 EDLVLXILLYIVIIPVASLEIRSLP
TM7 257 276 NXRRITFGDAPVEXLNNMCC

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage