Protein information for: OR4A19P



MELRTNVTDFVLLCFTQNPKEQKVLFVMFLLFYILTMVGNLLIVVTVTVS
ETLGSPMYFFLAGLSFIDIIYSSSISHRLISDLFFGNNSISFPSCLAQLF
TEHLFGGSEVFLLLVMAYDLHYLVIMRQWVCVLLLVVSWVGGFLHSVFQL
SVIYGLPFCDLNVIDHFFCDMHPLLKLVCTDTHVIGLLVVANGGLGCTIV
FLLLLISYGVICDSLKNLSQKGRXKALSTCSSHITVVVFFFVPCIFMYAR
PARTFPIDKSVSVFYTVITPMLNPLIYTLRNSEMTSAMKKLWRRDFISSS
T
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 QKVLFVMFLLFYILTMVGNLLIVVTVT
TM2 59 81 FFLAGLSFIDIIYSSSISHRLIS
TM3 96 116 LAQLFTEHLFGGSEVFLLLVM
TM4 131 151 CVLLLVVSWVGGFLHSVFQLS
TM5 188 209 LVVANGGLGCTIVFLLLLISYG
TM6 230 254 CSSHITVVVFFFVPCIFMYARPART
TM7 259 276 SVSVFYTVITPMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage