Protein information for: OR4A21P



FCLQVLTPXSNTFRRTHGKXEKLTXILLGLTQNPEGQKVLFVTFLLIYIV
TIMGNLLIMVTIMASQSLGSPMYFFLASLSFIHTVYYTAIAPKMIVDLLS
EKKTISFQGCMAQLFMDHLFAGAEVILLVVMAYDQYVAICKPLHYLIIMN
CRVCVLMLLVAWIGGFLHSLVQFLFIYQLPFCGPNVIDNFLCDLYPLLKL
ACTNTYVTGLSMIANGGAICTVTFFPLLLSYGVILPSLKTQSLEGKCKAF
YTCASHITVITLFFVPCIFLFARPNSTFPIDKSMTVVLTCITPMLKPLIY
ALRNAEMKSAMRKLWSEKVSLAGKGLYPS
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 37 63 QKVLFVTFLLIYIVTIMGNLLIMVTIM
TM2 74 96 FFLASLSFIHTVYYTAIAPKMIV
TM3 111 131 MAQLFMDHLFAGAEVILLVVM
TM4 154 174 CVLMLLVAWIGGFLHSLVQFL
TM5 211 232 SMIANGGAICTVTFFPLLLSYG
TM6 253 277 CASHITVITLFFVPCIFLFARPNST
TM7 282 299 SMTVVLTCITPMLKPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage