Protein information for: OR4A41P



REEXRGLSNNVTGFVLLGNTQDPDVQNALFVMVLLTYIVTTVGNLLIVVA
IIASPSLGSPIYFFLVCLSFIDAAYSTAICPKLTVELLHDKKTIFFTACM
GQLFKDHLFGGAEVFLLVGMVYDRYVADCKPLHYFTIMNRQVCILLLLMA
VTGGFMNSVFQIVVYNLPFCGASVTDHFVCDVYPLLELACTDTYFIGLTV
VASGGAMCMFVFTLLLISYGVILVXVVYLKTYSQEGRCKTFSACISCITV
VVLFLVPCIFLFVRPVLNFPIDKFMTVFYTVITPPMLNSLIYTLRNVEMR
IAVKTNVKKLWHKNXTIV
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 26 52 QNALFVMVLLTYIVTTVGNLLIVVAII
TM2 63 85 FFLVCLSFIDAAYSTAICPKLTV
TM3 100 120 MGQLFKDHLFGGAEVFLLVGM
TM4 143 163 CILLLLMAVTGGFMNSVFQIV
TM5 199 220 TVVASGGAMCMFVFTLLLISYG
TM6 244 268 CISCITVVVLFLVPCIFLFVRPVLN
TM7 273 291 FMTVFYTVITPPMLNSLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage