Protein information for: OR4A42P



MRQNNNISEFVLLGFSQDPGVQKALFVMFLLTHLVTVVGNLLIVVTIIAS
PSLGSPVYFFLACLSFIDAAYSTTISPKLIVDLLCDKKTISFPGCMGQLF
IDHFFGSAEVFLLVVMACDRYVAICKPLHYLTIMNRQVCFLLLVVAMIGG
FVHSAFQIVVYSLPFCGPNVIDHFGCDMYPLLKVACTDTYFVGLTVVFNS
GAICMVIFTLLLISCGVILNSLKSQEKRHKALSTCSSRITVVALFFVPCI
FIYVRPVSNFPTDKFMTVSYTIITHMLSPLIYTLRNXEMRNAIEKLLGKK
LTIFSNRSVRP
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 QKALFVMFLLTHLVTVVGNLLIVVTII
TM2 59 81 FFLACLSFIDAAYSTTISPKLIV
TM3 96 116 MGQLFIDHFFGSAEVFLLVVM
TM4 139 159 CFLLLVVAMIGGFVHSAFQIV
TM5 195 216 TVVFNSGAICMVIFTLLLISCG
TM6 235 259 CSSRITVVALFFVPCIFIYVRPVSN
TM7 264 281 FMTVSYTIITHMLSPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage