Protein information for: OR4A45P



MRQNNSITEFVFLGFSQDPDVQNALFVMFLLTYIVSVVGNLLIVMTIIAS
PSLGSPVYFFLTCLSFIEAVYSTTISPVLIVDFLCDKKTISFRACMGQLF
IDHLFGGEIFLLVMMAWDRYMAICKPLHYLTIMNQQVCILLFVLAMTGGF
VHSVFQIVVVYCLPFCGPNAIDHFYCDMYPLLELACTDTYFIGLTVVFNG
GAICMVTFTLLLISYRVILNSLKTYSQERRHKALSTCRSHITVVVLFFVP
CIFMYVRPVSNFSIDKFLTVFYAVITPMLNPFIYALRNSEMRTAIEKLFG
TMSYN
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 QNALFVMFLLTYIVSVVGNLLIVMTII
TM2 59 81 FFLTCLSFIEAVYSTTISPVLIV
TM3 96 115 MGQLFIDHLFGGEIFLLVMM
TM4 138 158 CILLFVLAMTGGFVHSVFQIV
TM5 195 216 TVVFNGGAICMVTFTLLLISYR
TM6 237 261 CRSHITVVVLFFVPCIFMYVRPVSN
TM7 266 283 FLTVFYAVITPMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage