Protein information for: OR4A46P



LEXGHTERRTEQRNNVTEFVLVGLTQSPQGQKILFVVFLLIYIVTMVGNI
FIVVTVVVSPTLGCPMYFFLVYLSFMDAVHSTTVTPNMIIYLLYEKKTIS
FQACMTQLFIGHPFGGAEILLLVVMAYEGYVAICKPLHYLTIMNQRVCIL
LLLLAWAGGFLHAVVQLLFVYNFPFCGPNVIEHFICDMYPLLKLACTDTY
VIGLTVVANDGAICVVIFMLLLISYRVILHSLKNLSEEGRPKALSTCGSH
ITGVILFFVPCILMYVRPPSTLPIDKSLTVFYTVITPMLNPLIYTLRNAE
MKNAMKKLWTRKRK
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 31 57 QKILFVVFLLIYIVTMVGNIFIVVTVV
TM2 68 90 FFLVYLSFMDAVHSTTVTPNMII
TM3 105 125 MTQLFIGHPFGGAEILLLVVM
TM4 148 168 CILLLLLAWAGGFLHAVVQLL
TM5 205 226 TVVANDGAICVVIFMLLLISYR
TM6 247 271 CGSHITGVILFFVPCILMYVRPPST
TM7 276 293 SLTVFYTVITPMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage