Protein information for: OR4A48P



LFSKHLVRASWQLVNFLMYSTALISTLSLHVLFYFNFYHFFPTXKVLQSL
RNAEINXLVXKVYDXRNLHXSXLAFSWTIRLAQPLRTQTCISLSNVVXPS
TQLFTAHFFLGGSQVFLLLVMAXTTYRAIXKSLQYLVVMKQWLCVVLLVV
LWAGGFLHTVIQLDLIHGLPSYDPNVIGHFVCNMDPLMKLVCDYTLNRFA
YFAGHDLNTMVLYISFTFRLDCFLLVIXLCYSFVIFSLEXHGSINLVIHS
YYPCGVS
No N-glycosylation site was found.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 25 51 STLSLHVLFYFNFYHFFPTXKVLQSLR
TM2 63 85 YDXRNLHXSXLAFSWTIRLAQPL
TM3 101 121 TQLFTAHFFLGGSQVFLLLVM
TM4 144 164 CVVLLVVLWAGGFLHTVIQLD
TM5 174 195 PNVIGHFVCNMDPLMKLVCDYT
TM6 205 228 HDLNTMVLYISFTFRLDCFLLVIX
TM7 230 249 CYSFVIFSLEXHGSINLVIH

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage