Protein information for: OR4A49P



MTEFVLVGLTQSPQGQKILFVVFLLIYLVTMVGDILIVVTVVVSPTLDAP
MYFFLGYLSLMDAVXSSGEAACFGSIFIXKXSIDLPRCLEYLIIPLLFSI
PPSHGLLKNSQALLFICKISIIHNLXTSNMQCRAXXQIFW
No N-glycosylation site was found.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 16 42 QKILFVVFLLIYLVTMVGDILIVVTVV
TM2 53 74 FFLGYLSLMDAVXSSGEAACFG
TM3 89 109 LEYLIIPLLFSIPPSHGLLKN
TM4 132 140 CRAXXQIFW
TM5 140 139
TM6 140 139
TM7 140 139

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage