Protein information for: OR4A4P



MEPRKNVTDFVLLGFTQNPKEQKVLFVMFLLFYILTMVGNLLIVVTVTVS
ETLGSPMSFFLAGLTFIDIIYSSSISPRLISDLFFGNNSISFQSFMAQLF
IEHLFGGSEVFLLLVMAYDRYVAICKPLHYLVIMRQWVCVLLLVVSWVGG
FLQSVFQLSIIYGLPFCGPNVIDHFFCDMYPLLKLACTDTHVIGLLVVAN
GGLSCTIAFLLLLISYGVILHSLKKLSQKGRQKAHSTCSSHITVVVFFFV
PCIFMCARPARTFSIDKSVSVFYTVITPMLNPLIYTLRNSEMTSAMKKLX
SRDLISSST
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 QKVLFVMFLLFYILTMVGNLLIVVTVT
TM2 59 81 FFLAGLTFIDIIYSSSISPRLIS
TM3 96 116 MAQLFIEHLFGGSEVFLLLVM
TM4 139 159 CVLLLVVSWVGGFLQSVFQLS
TM5 196 217 LVVANGGLSCTIAFLLLLISYG
TM6 238 262 CSSHITVVVFFFVPCIFMCARPART
TM7 267 284 SVSVFYTVITPMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage