Protein information for: OR4A5



MRQNNNITEFVLLGFSQDPGVQKALFVMFLLTYLVTVVGNLLIVVDIIAS
PSLGSPMYFFLACLSFIDAAYSTTISPKLIVGLFCDKKTISFQGCMGQLF
IDHFFGGAEVFLLVVMACDRYVAICKPLHYLTIMNRQVCFLLLVVAMIGG
FVHSAFQIVVYSLPFCGPNVIVHFSCDMHPLLELACTDTYFIGLTVVVNS
GAICMVIFNLLLISYGVILSSLKTYSQEKRGKALSTCSSGSTVVVLFFVP
CIFIYVRPVSNFPTDKFMTVFYTIITHMLSPLIYTLRNSEMRNAIEKLLG
KKLTIFIIGGVSVLM
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 QKALFVMFLLTYLVTVVGNLLIVVDII
TM2 59 81 FFLACLSFIDAAYSTTISPKLIV
TM3 96 116 MGQLFIDHFFGGAEVFLLVVM
TM4 139 159 CFLLLVVAMIGGFVHSAFQIV
TM5 195 216 TVVVNSGAICMVIFNLLLISYG
TM6 237 261 CSSGSTVVVLFFVPCIFIYVRPVSN
TM7 266 283 FMTVFYTIITHMLSPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage