Protein information for: OR4A6P



LQVLFSXALNCDRSLREEXRGLSNNVTEFVLLGNTQCPDVQNALFVMVLL
TYVVSMAGNLLAVVAIISSPSFGSPMYFFLTCLLFIYAAYSNTISPKLII
GLLHDKKTIFFTACMGQLFIDHLFGGAEVFLLVGMSYDFYVAISKPLHYL
TIMNQQVCILLLVVAVTGGFVSCVFQIVVVYTLSFCGPNVTDHFVCDMYP
LLELVCTDTYFIGLTVVANGLAICMVVFTLLLISYGVILNNFKTYSQEGR
LKALSACISYITVTVLFLVPCIFLFVRPVSNFPIDKFMTVFYTVIIHMLN
PLIYTLRNLEMRIAVKSNVKKLWH
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 41 67 QNALFVMVLLTYVVSMAGNLLAVVAII
TM2 78 100 FFLTCLLFIYAAYSNTISPKLII
TM3 115 135 MGQLFIDHLFGGAEVFLLVGM
TM4 158 178 CILLLVVAVTGGFVSCVFQIV
TM5 215 236 TVVANGLAICMVVFTLLLISYG
TM6 257 281 CISYITVTVLFLVPCIFLFVRPVSN
TM7 286 303 FMTVFYTVIIHMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage