Protein information for: OR4A9P



MRPNNSITEFVLLGFSQDPGMQKELFVMFLFTYVVTVLGNQLIVVTIIAS
PSLGSPMYFFLACLSFIDAAYFTVISPKLIVDLLCDKKTISFQTFMGQLF
IDHFFGGAEAFLLVVMAYDRYVAICKTLHYLTIMTRQVCILALLVAATGG
FVHSVFQIVVVYSLPFCGANVIDHFSCDMYPLLELAXTDTYFIGLTVVFS
GGALCMVIFTLLIISYRVILNSLKTYTQEGRHKALSTCSSHITVIVLFFI
PCIFIYVRPVSNFSIDTFMTVFYTVITPKLNPLIYTFRNSEMRNVIEKLL
VKKVTIFRITGSILM
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 QKELFVMFLFTYVVTVLGNQLIVVTII
TM2 59 81 FFLACLSFIDAAYFTVISPKLIV
TM3 96 116 MGQLFIDHFFGGAEAFLLVVM
TM4 139 159 CILALLVAATGGFVHSVFQIV
TM5 196 217 TVVFSGGALCMVIFTLLIISYR
TM6 238 262 CSSHITVIVLFFIPCIFIYVRPVSN
TM7 267 284 FMTVFYTVITPKLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage