Protein information for: OR4B2P



MASTNNVTESMITSLFQDPAVQRVCFVVFLPVYVAMEVGNGLIVLTVSIS
KSLHSPVYFFLSYLSLMEISYFTVVPKFITDLLAKIKAISLEGYLAQIFL
HFFGIPWIFLLPLMTNDQYMANCKLYYYTTIMSCRVCHLLVAGFWLRGII
HSMVQILVSVQLFFCGPNMIDHSFCDLQVLFKLACTDTFVEGVIVLANSE
LVSVFFLILVSSYIIILVNLRNHSAEGRCKALSTCASYLVFXTCIFLYVX
LSSTFTKDKLVAVFYVVITPMLNPFIYTLGNAEMKITMRRLLGRTVNSGM
E
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 QRVCFVVFLPVYVAMEVGNGLIVLTVS
TM2 59 80 FFLSYLSLMEISYFTVVPKFIT
TM3 95 114 LAQIFLHFFGIPWIFLLPLM
TM4 137 157 CHLLVAGFWLRGIIHSMVQIL
TM5 193 214 VIVLANSELVSVFFLILVSSYI
TM6 235 254 CASYLVFXTCIFLYVXLSST
TM7 259 276 LVAVFYVVITPMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage