Protein information for: OR4C14P



MGTSNNETEFILLGITKNPELRKIFSALFLAMYVTTVLGNLFIVVTLAAS
WSLRSPMYFSLTSLSLMGATYSSITAPKMTVDLFENTTISLEGCMTQLFA
EHFSDGVAIILLTVMVCDCYEAISKPLHDTTIMSPRVCVLLVVEAWVGGL
THATIQLFFFIYQIPFCGPNIIDHFICDLFPLLKLAYMDTHMLGLLVILN
SGVMCMAIFLILIASYIVTLYSLKSCSSVGXRNTLSTCGSHHTVVILFFV
ECIFLYIRPVVTYPIDKDMAISFTIVAPMLNPLIYTLRGIKVKNAIRKMW
MKQGTLGG
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 RKIFSALFLAMYVTTVLGNLFIVVTLA
TM2 59 81 FSLTSLSLMGATYSSITAPKMTV
TM3 95 115 MTQLFAEHFSDGVAIILLTVM
TM4 138 158 CVLLVVEAWVGGLTHATIQLF
TM5 196 217 LVILNSGVMCMAIFLILIASYI
TM6 238 262 CGSHHTVVILFFVECIFLYIRPVVT
TM7 267 284 DMAISFTIVAPMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage