Protein information for: OR4C1P



MDHHMPPNNVTEFILLGLTQNPHLQKILFIVFLFIFLFTMLANLFIVITI
SCSPTLSSPMYFFLTYLSFIDASYTSVTTPKMITDLLYQRRTISLAGCLT
QLFVEHLLGGSEIILLIVMAYDRYVAICKPLHYTTIMQQGICHLLVVIAW
IGGILHATVQILFMTDLPFCGPNVIDHFMCDLFPLLKLACRDTYRLGMLV
AANSGAMCLLIFSLLVISYIVILSSLKSYSSEGQHKALSTCGSHFTVVVL
FFVPCIFTYMHPVVTYSVDKLVTVFFAILTPMLNPIIYTVRNTEVKNAVR
SLLRKRVTVYA
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 25 51 QKILFIVFLFIFLFTMLANLFIVITIS
TM2 62 84 FFLTYLSFIDASYTSVTTPKMIT
TM3 99 119 LTQLFVEHLLGGSEIILLIVM
TM4 142 162 CHLLVVIAWIGGILHATVQIL
TM5 199 220 LVAANSGAMCLLIFSLLVISYI
TM6 241 265 CGSHFTVVVLFFVPCIFTYMHPVVT
TM7 270 287 LVTVFFAILTPMLNPIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage