Protein information for: OR4C49P



MEIPHNITEFVMLGLSQNSEVQRVLFVVFYVVTVCGNMLIVVTITSSPTL
ASPVYFFLANLSFIDTFYSFSMAPKLIADSLYEGRTISYECCMAQLFGAH
FLGGVEIILLTLMAYDHYVAICKPLHCTTIMTRHLCAMLVGVAXLGGFLH
SLVQLLLVLWLLFCGPNVINHFVCDLYPLLGVGCTNMHVIGLLVVANSGL
ICLLNFLMLAASYIVILYSLRSHSADGRRKALSTCGAHFIVFALFFVPCI
FTYMLPFSILSIDKNMALFYGILTPMLNPLIYTLRNEEVKNAMRKLFTW
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 19 45 SEVQRVLFVVFYVVTVCGNMLIVVTIT
TM2 56 78 FFLANLSFIDTFYSFSMAPKLIA
TM3 93 113 MAQLFGAHFLGGVEIILLTLM
TM4 136 156 CAMLVGVAXLGGFLHSLVQLL
TM5 193 214 LVVANSGLICLLNFLMLAASYI
TM6 235 259 CGAHFIVFALFFVPCIFTYMLPFSI
TM7 264 281 NMALFYGILTPMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage