Protein information for: OR4C5



MYVSNCNPCAIHRKINYPNTKLDFEQVNNITEFILLGLTQNAEAQKLLFA
VFTLIYFLTMVDNLIIVVTITTSPALDSPVYFFLSFFSFIDGCSSSTMAP
KMIFDLLTEKKTISFSGCMTQLFVEHFFGGVEIILLVVMAYDCYVAICKP
LYYLITMNRQVCGLLVAMAWVGGFLHALIQMLLIVWLPFCGPNVIDHFIC
DLFPLLKLSCTDTHVFGLFVAANSGLMCMLIFSILITSYVLILCSQRKAL
STCAFHITVVVLFFVPCILVYLRPMITFPIDKAVSVFYTVVTPMLNPLIY
TLRNTEVKNAMKQLWSQIIWGNNLCD
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 45 71 QKLLFAVFTLIYFLTMVDNLIIVVTIT
TM2 82 104 FFLSFFSFIDGCSSSTMAPKMIF
TM3 119 139 MTQLFVEHFFGGVEIILLVVM
TM4 162 182 CGLLVAMAWVGGFLHALIQML
TM5 219 240 FVAANSGLMCMLIFSILITSYV
TM6 253 277 CAFHITVVVLFFVPCILVYLRPMIT
TM7 282 299 AVSVFYTVVTPMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage