Protein information for: OR4C50P



MKNKRNVTEFILTGLTQNPKMEKIMFAVFLVPYMITLSGNLLIVVTITTS
QALISPMYFFLTHLSLIDTVYSSSSAPKLIADSLHEKKIISFNGCMAQAY
AEHIFGATEIILLTVMACDHNVAICKPLHYTTIMSQSLCILLAVVAWMGG
FLHATIQILFTVWLPFCGPNVIDHFMCDLYPLLKLVCLDTHTLGFFVAAN
SGFICLLNFLLXMVSCVIILRSLKNYSLEGKGKALSTCISHIIVIVLFFV
PCIFVYLCPVTTLHIEKAAAVFYTMVVPMLNPLIYTLRNAELKSVIRKLW
RKKVISDNN
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 EKIMFAVFLVPYMITLSGNLLIVVTIT
TM2 59 81 FFLTHLSLIDTVYSSSSAPKLIA
TM3 96 116 MAQAYAEHIFGATEIILLTVM
TM4 139 159 CILLAVVAWMGGFLHATIQIL
TM5 196 217 FVAANSGFICLLNFLLXMVSCV
TM6 238 262 CISHIIVIVLFFVPCIFVYLCPVTT
TM7 267 284 AAAVFYTMVVPMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage