Protein information for: OR4C7P



CFLFRXCNCHHLKYMANRNNVTEFILLGLTENPKMQKIIFVVFFIYITTM
IGNVLIVVTITASPSLRSPMXFFLAYLSFIDACYSSVNVSKLITDSLYEN
KTILLNGCMTQVFGEHFFRGVEVILLTVMAYDCYVVICKPLRYTTIMKQH
VCSLLVGVSRVGGFLHATIQILFIFQLPFCSSNVIDHFTCDLNPLLNLAC
TNTHTLGLFVAANSGFICLLNFLLLLVSYVVILYSLRTHSLEARHKGLST
CVSHNTVVILFFIPCIFVYMRPPATLPIDKAVAVFYTMITPMLNPLIYTL
RNAQMKNAIRKLCSRKAISSVK
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 35 61 MQKIIFVVFFIYITTMIGNVLIVVTIT
TM2 72 94 FFLAYLSFIDACYSSVNVSKLIT
TM3 109 129 MTQVFGEHFFRGVEVILLTVM
TM4 152 172 CSLLVGVSRVGGFLHATIQIL
TM5 209 230 FVAANSGFICLLNFLLLLVSYV
TM6 251 275 CVSHNTVVILFFIPCIFVYMRPPAT
TM7 280 297 AVAVFYTMITPMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage