Protein information for: OR4C9P



CFLFRYCNXPPFEIMVNRNNVTEFILLGLIENPKMQKIIFVVFFIYITTM
IGNVLIVVTVTASPSLRSPMYFYLAYLSFIDACYSSVNAPKLITDSLYEN
KTILLNGCMTQVFGEHFFGGVEVILLTVMAYDRYVVICKPLHYTTIMKQH
VCSLLVGVSWVGGFLHATVQILFIFQLPFCGPNVIDHFMWDLNPLLNLVC
TNTHTLGLFVAANSGFICLLNFLLLLVSYMVILYSLRTHSLEARCKALST
CVSHITVVILFFIPCIFVYMRPPATLPIDKAVAVFYTMIAPMLNPLIYTL
RNAQMKNAIRKLCSRKAI
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 35 61 MQKIIFVVFFIYITTMIGNVLIVVTVT
TM2 72 94 FYLAYLSFIDACYSSVNAPKLIT
TM3 109 129 MTQVFGEHFFGGVEVILLTVM
TM4 152 172 CSLLVGVSWVGGFLHATVQIL
TM5 209 230 FVAANSGFICLLNFLLLLVSYM
TM6 251 275 CVSHITVVILFFIPCIFVYMRPPAT
TM7 280 297 AVAVFYTMIAPMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage