Protein information for: OR4D7P



PSITKSLPRWLKNKKKHDPIEQGNYTRVKEFFFQGLTQSQELSLVLFLFL
FFVYSATVLGNLLIMVVVTCESRLHTPTYFLLCNLSVLVICFSSITARKV
LIDLSSRKTISFNGCMTQMFFFHLLGGTDVFSLFVMAFDQYMAIFKPLHC
VTIVSSRGREXGAGLIMASWVGGFVHSIVQVFLLLPLPFCGHHMIDGFYC
DVPQVLKLACTHTFALEVLMISNNGLISMLWFIFLLISYTVILMMLRSHT
EEGRRKAIATCTSHITVVTLHFVPCIYVHAQPSLPFPTDRAVSITFTVII
PVLNPMIYTLRNQEMKSALRRRKKRPSGKG
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 43 69 SLVLFLFLFFVYSATVLGNLLIMVVVT
TM2 80 102 FLLCNLSVLVICFSSITARKVLI
TM3 116 136 MTQMFFFHLLGGTDVFSLFVM
TM4 162 182 GAGLIMASWVGGFVHSIVQVF
TM5 219 240 LMISNNGLISMLWFIFLLISYT
TM6 261 285 CTSHITVVTLHFVPCIYVHAQPSLP
TM7 290 307 AVSITFTVIIPVLNPMIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage