Protein information for: OR4E1P



MEEAILLNQTSLVTYFRLRGLSVNHKARIAMFSMFLIFYVLTLIGNVLIV
ITIIYDHRLHTPMYFFLSNLSFIDVCHSTVTVPKMLRDVWSEEKLISFDA
CVTQMFFLHLFACTEIFLLTVMAYDRYVAICKPLQYMIVMNWKVCVLLAV
ALWTGGTIHSIALTSLTIKLPYCGPDEIDNFFCDVPQVIKLACIDTPVLE
ILIVSNSGLISVVCFVVLVVSYAVILVSLRQQISKGKWKALSTCAAHLTV
VTLFLGHCIFIYSRPSTSLPEDKAVSVFFTAVTPLLNPIIYTLRNEEMKS
ALNKLVGRKERKEEK
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 28 54 RIAMFSMFLIFYVLTLIGNVLIVITII
TM2 65 87 FFLSNLSFIDVCHSTVTVPKMLR
TM3 102 122 VTQMFFLHLFACTEIFLLTVM
TM4 145 165 CVLLAVALWTGGTIHSIALTS
TM5 202 223 LIVSNSGLISVVCFVVLVVSYA
TM6 244 268 CAAHLTVVTLFLGHCIFIYSRPSTS
TM7 273 290 AVSVFFTAVTPLLNPIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage