Protein information for: OR4F14P



MVGANHSVVSEFVFLGLTNSWEIRLLLLVFSSMFYMASMMGNSLILLTVT
SDPHLHSPMYFLLANLSFIDLGVSSVTSPKMIYDLFRKHEVISFGGCIAQ
IFFIHVIGGVEMVLLIAMAFDRYVAICKPLQYLTIMSPRMCMFFLVAAWV
TGLIHSVVQLVFVVNLPFCGPNVSDSFYCDLPRFIKLACTDSYRLEFMVT
ANSGFISLGSFFILIISYVVIILTVLKHSSAGLSKALSTLSAHVSVVVLF
FGPLIFVYTWPSPSTHLDKFLAIFDAVLTPVLNPIIYTFRNXEMKVAMRK
VCRQLVNHRKIS
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 RLLLLVFSSMFYMASMMGNSLILLTVT
TM2 61 83 FLLANLSFIDLGVSSVTSPKMIY
TM3 98 118 IAQIFFIHVIGGVEMVLLIAM
TM4 141 161 CMFFLVAAWVTGLIHSVVQLV
TM5 198 219 MVTANSGFISLGSFFILIISYV
TM6 240 264 LSAHVSVVVLFFGPLIFVYTWPSPS
TM7 269 286 FLAIFDAVLTPVLNPIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage