Protein information for: OR4F4



MVTEFIFLGLSDSQELQTFLFMLFFVFYGGIVFGNLLIVITVVSDSHLHS
PMYFLLANLSLIDLSLSSVTAPKMITDFFSQRKVISFKGCLVQIFLLHFF
GGSEMVILIAMGFDRYIAICKPLHYTTIMCGNACVGIMAVAWGIGFLHSV
SQLAFAVHLPFCGPNEVDSFYCDLPRVIKLACTDTYRLDIMVIANSGVLT
VCSFVLLIISYTIILMTIQHCPLDKSSKALSTLTAHITVVLLFFGPCVFI
YAWPFPIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRRLRKWDAH
SSVKF
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 17 43 QTFLFMLFFVFYGGIVFGNLLIVITVV
TM2 54 76 FLLANLSLIDLSLSSVTAPKMIT
TM3 91 111 LVQIFLLHFFGGSEMVILIAM
TM4 134 154 CVGIMAVAWGIGFLHSVSQLA
TM5 191 212 MVIANSGVLTVCSFVLLIISYT
TM6 233 257 LTAHITVVLLFFGPCVFIYAWPFPI
TM7 262 279 FLAVFYSVITPLLNPIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage