Protein information for: OR4G4P



MDRVNNSAVSKFVLIGLSSSWEMHLFLFWFFSVFYMGIILENLFIVFTVI
IDSHLNSPVYCLLANIYLLDLVFSYSSDFFTNCSIISFPRCIIQIFFICV
MRKIEMVLLITMAXSRYTAICKPPHYLTTMNPKMCVSLLEASWIVRIIHA
VSQFVFAINLPFCGPNRVGSFHCDFPYVMKLACVDTYKLEVVVTANSGLI
SIATCFLLIISYIFISVTVXNPSSGDLSKAFVSCSDHITVGILFFMPCIF
LYVXPLPKTTHDXYLFIVPLLSPLSRIYTLRNKDMNVSMERLGKWIAGSS
RMSXXMVHHPECKM
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 HLFLFWFFSVFYMGIILENLFIVFTVI
TM2 61 83 CLLANIYLLDLVFSYSSDFFTNC
TM3 92 112 IIQIFFICVMRKIEMVLLITM
TM4 135 155 CVSLLEASWIVRIIHAVSQFV
TM5 192 213 VVTANSGLISIATCFLLIISYI
TM6 234 258 CSDHITVGILFFMPCIFLYVXPLPK
TM7 263 277 YLFIVPLLSPLSRIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage