Protein information for: OR4H6P



MKVANNVTEFIFLGLSQDSGMQLMFFVLFLLFYVVIMVGNLLILLMVFSD
SRLHTPMYFFLSNLSFVDIAYSSPTAPKMIEDFVSEKKTISYWGCITXMF
TFHFFGCAEIFVLTVMAFDRYAAICQSLRYTVIMSANAYTVLASLSWLGA
LGHSFVQTLLTFQLPFCNAQVIDHYFCDVHPVLKLACADTTLVNMLVVAN
SGLISLGCFLILLASYTVILFSLQKQSAESXHKVLSTCGSHLTIVTFFFV
PCIFIYRPSTTFPLDKAVSVFYTTITPMLNPLIYTLRNEEIKNAMRRLWS
SKISLKEKQRG
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 QLMFFVLFLLFYVVIMVGNLLILLMVF
TM2 59 81 FFLSNLSFVDIAYSSPTAPKMIE
TM3 96 116 ITXMFTFHFFGCAEIFVLTVM
TM4 139 159 YTVLASLSWLGALGHSFVQTL
TM5 196 217 LVVANSGLISLGCFLILLASYT
TM6 238 261 CGSHLTIVTFFFVPCIFIYRPSTT
TM7 266 283 AVSVFYTTITPMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage