Protein information for: OR4K11P



MNETNHSWVTEFVLLGLSSSRELQPFLFLIFSLLYLAILLGNFLIILTVT
SDSRLHTPMYFLLANLSFIDVCVASSATPKMIADFLVEHKTISFDARLAQ
IFFVHLFTGSEMVLLVSMAYDRYVAICKPPHYMTIMSCCVCVVLFLISWF
VGFIHTTSQLAFTVNLPFCGPNKVDSFFCDLPLVTKLACIDTYVVSLLIV
ADSGFLSLSSFLLLVVSYTVILVTVRNSSSVSMVKACSTLTAHITVVTLF
FGPCIFIYVWPFSSYSVDKVLAVFYTIFTSILNPVIYMLRNKEVKAAMSK
LKSRYQKLGQVSVVIRNV
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 QPFLFLIFSLLYLAILLGNFLIILTVT
TM2 61 83 FLLANLSFIDVCVASSATPKMIA
TM3 98 118 LAQIFFVHLFTGSEMVLLVSM
TM4 141 161 CVVLFLISWFVGFIHTTSQLA
TM5 198 219 LIVADSGFLSLSSFLLLVVSYT
TM6 240 264 LTAHITVVTLFFGPCIFIYVWPFSS
TM7 269 286 VLAVFYTIFTSILNPVIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage